firepower export rules to csv

"event" : "MessagesWidgetEditAnswerForm", When an export job completes, the export file is written to the system disk and is called a configuration file. }, "context" : "envParam:quiltName", { "quiltName" : "ForumMessage", { 04-22-2020 For Virtual Network rules, Get-AzSqlServerVirtualNetworkRule -ResourceGroupName "RG-Name" -ServerName "Server-Name" Copy the above the script script and replace the attributes accordingly to export them to CSV files. "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ Are you sure you want to proceed? { .PARAMETER Name. "context" : "", { "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_10f5b27f97c75be', 'enableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'wdtdOY0r680ovxDb51LaDz2GeQdiwOnFkjdygWVsEsk. Use these resources to familiarize yourself with the community: The display of Helpful votes has changed click to read more! export file. File Export-Policies.py, line 147, in "event" : "AcceptSolutionAction", ] ] The configuration itself is represented as objects defined using attribute-value pairs in a JSON-formatted text file. For example, "type=networkobject". }, "context" : "", "event" : "kudoEntity", { ] "action" : "rerender" { configExportTypeOne of the following enum values: FULL_EXPORTInclude the entire configuration in the export file. LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_1","messageId":56155,"messageActionsId":"messageActions_1"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "actions" : [ { "event" : "removeThreadUserEmailSubscription", { LITHIUM.AjaxSupport.ComponentEvents.set({ However, you should directly define objects only in cases where you are importing a small number of changes, such as Are you sure you want to proceed? { "context" : "", { "event" : "MessagesWidgetAnswerForm", To export the data for a report, at the top of the page, click Export > CSV. LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; the unexportable objects will be excluded from the output even if you specify their identities. You can alternatively use the GET /jobs/configexportstatus/{objId} method to retrieve status for a specific job. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", If you configured remote access VPN, the AnyConnect packages and any other referenced files, such as client profile XML files, REST API Client Using OAuth, Comparing Import/Export and Backup/Restore, Guidelines for Configuration Import/Export, Basic Structure of Identity Wrapper Objects, Example: Editing a Network Object for Import Into a Different Device, Import the Configuration and Check Job Status. "event" : "MessagesWidgetAnswerForm", Use the DELETE /action/configfiles/{objId} method, using the file name as the objId value. manager, or use GET calls in the API, during the export job. "action" : "rerender" "context" : "", "action" : "rerender" It takes some time for an export job to complete. This website uses cookies to improve your experience. } I want to have everything organized in one centralized location that gives me the following information below: 1. "action" : "addClassName" { { "context" : "lia-deleted-state", If you need to reset the device configuration prior to import, you can go to the device "context" : "", In Version 8, we have made this capability easier to access, moving it right on the list views where you can not only export the entire list, but also search and filter the list and export the filtered result set. } LITHIUM.AjaxSupport.ComponentEvents.set({ https:///api/fmc_config/v1/domain/{domainUUID}/policy/accesspolicies, And the result should be something like this. As such, users commonly will commonly export data into a spreadsheet due to familiarity, a legacy process requirement or additional analysis. ] }, excludeEntities(Optional.) "selector" : "#labelsTaplet", "context" : "envParam:selectedMessage", The Import Deployment.. Apply targeted configurations. LITHIUM.AjaxSupport.useTickets = false; }, on the threat "linkDisabled" : "false" } ], you can generate them in pdf but not in csv. ] Each object is structured like the following, which is a network host object that defines the IP address of the syslog server: Suppose you exported this object from a device, and you want to import the object into a different device, but the new device "action" : "rerender" Primarily, this is for recovering the last good "context" : "envParam:entity", { Whether to keep the copy of the configuration file imported on the threat Excel is not friendly to CSV files). "event" : "MessagesWidgetEditCommentForm", LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "markAsSpamWithoutRedirect", "message" : "56164", In FMC, go to Policies > Access Control. "context" : "", FireMon has been at the forefront of the security management category, delivering first-ever functionality such as firewall behavior testing, workflow integration, traffic flow analysis and rule recertification. "actions" : [ "}); { "action" : "rerender" { changes. A limited number of objects are ContainedObjects, which have a relationship to an object that contains them. Backup/restore is for disaster recovery. Any idea how this can be done for exporting my 50 NAT policies from FMC into a single .csv file please? "displayStyle" : "horizontal", "event" : "MessagesWidgetEditAction", { Is there a way to export them as a CSV or XLS file (perhaps through the shell) so we can have them in a neat and clean report? } typeThe job type, which is always scheduleconfigexport. "disableLinks" : "false", All rights reserved. "message" : "56153", defense system, you can import the objects defined in the configuration file into the threat explain each step. "showCountOnly" : "false", { }, Whether to automatically start a deployment job if the import is successful. "actions" : [ { The following topics explain more about configuration import/export. }); }, "actions" : [ - "forceSearchRequestParameterForBlurbBuilder" : "false", We'll assume you're ok with this, but you can opt-out if you wish. ], "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" LITHIUM.Placeholder(); { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "removeThreadUserEmailSubscription", defense disk. https://developer.cisco.com/codeexchange/github/repo/meraki/automation-scripts/, \\n\\t\\t\\t\\t\\t\\tSorry, unable to complete the action you requested.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f5b27f9bb0b83', 'disableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'RurIi0Od4cZkShAhmcw0pTq5tqF1_C5eiEqjW07xiT0. } "kudosLinksDisabled" : "false", LITHIUM.Components.renderInPlace('recommendations.widget.recommended-content-taplet', {"componentParams":"{\n \"mode\" : \"slim\",\n \"componentId\" : \"recommendations.widget.recommended-content-taplet\"\n}","componentId":"recommendations.widget.recommended-content-taplet"}, {"errorMessage":"An Unexpected Error has occurred. { { "event" : "deleteMessage", "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gXBDXKy0Y47snhU8RwhnRGd3l9Mls2MVnakm5Ay5VbI. LITHIUM.Auth.CHECK_SESSION_TOKEN = 'BFax8h_frXFDP7PN8m0aPzGT3yFmcawFjIctkMv5dok. { manager or through the CDO, you can export the configuration of the device using the threat When importing objects, you also have the option of defining the objects directly in the import command rather than in a configuration { }, One of the simplest but most requested features is the ability to export rules and objects out of our system into CSV format for use in spreadsheets. "eventActions" : [ "event" : "removeMessageUserEmailSubscription", { { If you set this attribute to "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "addClassName" "event" : "addMessageUserEmailSubscription", 2018-06-13 09:28 PM. "componentId" : "kudos.widget.button", When you edit the file for import, specify the desired action. { { "actions" : [ "event" : "deleteMessage", { preserveConfigFile(Optional.) } "event" : "kudoEntity", "actions" : [ { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", Center. "parameters" : { } the import process does not validate licenses. { Because of this, we have made much of our data available to export into a spreadsheet format. "disableKudosForAnonUser" : "false", If you use this method from API Explorer, click the Choose File button next to the fileToUpload attribute to select the file from your workstation drive. manager on the Objects page), interface (all network interfaces, s2svpn (all site-to-site VPN related types), ravpn (all RA VPN related "}); ] For example, following is the metadata object from a Secure Firewall Threat Defense "truncateBodyRetainsHtml" : "false", ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "action" : "rerender" ","messageActionsSelector":"#messageActions_2","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_2","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "event" : "addMessageUserEmailSubscription", { Use commas to separate the objects in the configuration file. "actions" : [ { } "selector" : "#messageview_1", "event" : "markAsSpamWithoutRedirect", The system will automatically resolve relationships during import, "useCountToKudo" : "false", "actions" : [ If the import fails, you might need to edit the file "actions" : [ "kudosable" : "true", }, LITHIUM.AjaxSupport.ComponentEvents.set({ encryptionKeyThe key used to encrypt the zip file, if any. typeThe job type, which is always scheduleconfigimport. { "event" : "approveMessage", }, However, you can view the configuration in the device "context" : "", ] manager, threat You need to specify this console.log('Submitting header search form'); LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is Options. "actions" : [ LITHIUM.InlineMessageReplyEditor({"openEditsSelector":".lia-inline-message-edit","ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "disallowZeroCount" : "false", { 1 person had this problem I have this problem too Labels: Cisco Firepower Management Center (FMC) "event" : "RevokeSolutionAction", How many of you during a maintenance activity are fallen in the fatal question How can I export all Access Control Policy that are configured on my CiscoFMC?Well, if you are in this category I will show you what to do with a simple Python script. "event" : "MessagesWidgetCommentForm", "actions" : [ { the action is changed to EDIT; if the object does not exist, EDIT is changed to CREATE. The following topics explain the requirements for the text file. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); "eventActions" : [ "action" : "rerender" ] }, "actions" : [ } }); { "eventActions" : [ }, For objects that are part of an ordered list, such as access control and manual NAT rules, the position "actions" : [ 2). ', 'ajax'); You can actually omit this attribute if the parent is a single object (that is, you cannot create more than one), such as { ] "context" : "envParam:quiltName,expandedQuiltName", However, "actions" : [ Are you sure you want to proceed? { "actions" : [ All 1 to 1 NAT rules 3. "context" : "envParam:selectedMessage", "action" : "rerender" - A list of object matching strings that identify objects that should not be imported. "revokeMode" : "true", comma except for the final object. "action" : "rerender" "action" : "rerender" { { }); "eventActions" : [ Thanks in Advance, You can find all the script here: https://github.com/rnwolfe/fmc-tools, Your email address will not be published. { "action" : "rerender" 2020 FireMon, LLC. ] "componentId" : "forums.widget.message-view", "actions" : [ ], "}); "event" : "QuickReply", if (!$search.is(e.target) && $search.has(e.target).length === 0) { ] The documentation set for this product strives to use bias-free language. ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f5b27f97c75be_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f5b27fc731808', 'disableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'LfVrGgzpA4F3ZiTD9kSAXqtriwEFIpIGNYJHV8drAc8. This feature is available for Security Rule, Network Objects and Service Objects. Even thought it's not easy to read, it is useful in order to re-import it on another FMC. If you set autoDeploy to false, you need to run a deployment job to incorporate the imported changes. Get notified when there are additional replies to this discussion. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", defense version 6.5(0) or higher, and the threat } master fmc-tools/export-acp-to-csv.py Go to file Cannot retrieve contributors at this time executable file 149 lines (128 sloc) 5.56 KB Raw Blame # import required dependencies from __future__ import print_function from fireREST import FireREST # Set variables for execution. "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "rerender" "context" : "lia-deleted-state", "action" : "rerender" "linkDisabled" : "false" should use a syslog server at a different address, 192.168.5.15. }, These cookies do not store any personal information. "useSubjectIcons" : "true", "context" : "", and the action you are taking. "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "action" : "rerender" I believe you can use the cp_merge utility to do this. }, "showCountOnly" : "false", Is there a way i can do it . "action" : "rerender" "eventActions" : [ "disableKudosForAnonUser" : "false", We need to add in our header a key for X-auth-access-token with the value received in our first POST request and substitute {containerUUID} with our items.id value. of the object in the policy. Could you tell us a little about yourself and your role? "event" : "expandMessage", "useSimpleView" : "false", "action" : "rerender" If you are looking for tools to perform bulk rule changes or help convert from Layer4 rules to Layer7, like the PaloAlto Migration tool, you are out of luck. "event" : "QuickReply", "kudosable" : "true", "actions" : [ If you specify an encryption key, it is masked in the response. "revokeMode" : "true", { You may choose another option from the dropdown menu. Introducing FireMon Policy Analyzer Learn More. }, { that comprise the policy and related settings. The first object in the file must be a metadata object. "event" : "approveMessage", { "action" : "rerender" } "event" : "deleteMessage", }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_2","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LgvEYUsZoAhMrEr011OxgvAlM5rJd0dr_39LJsAfI6U. }); "context" : "", "event" : "addMessageUserEmailSubscription", Export rules from an exported SourceFire policy object (tested on 4.10 series sensors). "disableLabelLinks" : "false", }, the same software version, as the device from which the backup was taken. "action" : "rerender" file. Given the frequent demand, this may seem like a core product requirement. Configuration import/export is not the same as backup/restore. Not sure it exists in R65, but it can't hurt: Using cp_merge utility. The following example performs a full export to the file export-config-1 and accepts the defaults for all other attributes: For example, the curl command would look like the following: You should get a response code of 200. The other option would be to use the migration utilities to export the configuration, do a fresh install of R77.30 in a VM, migrate import the config, and use the tool in sk64501. "actions" : [ { "entity" : "56151", $search.removeClass('is--open'); Unfortunately on FMC you can not download Access Control Policy in a CSV file and the only way is to write an Excel file. "action" : "rerender" complete the reimage. "action" : "rerender" }, } You would You might also need to specify index for these objects. "action" : "rerender" { version and id attributes from the data attribute. Following is the basic structure of an identity wrapper object: The object contains the following attributes: dataThis is the collection of attribute-value pairs that define the object from the configuration, such as a network object, { "actions" : [ with commas. "disableLabelLinks" : "false", { Within limits, you can even import a file to different device models, for example, from the device The simplest way to get status is to use GET /jobs/configexportstatus. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_10f5b27f97c75be","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_10f5b27f97c75be_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RiOgHO09earyfyy7wkoYsRrHdCFMXNDZMfZNDJIV0oo. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper","componentSelector":"#threadeddetaildisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":56153,"confimationText":"You have other message editors open and your data inside of them might be lost. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"useLoader":true,"blockUI":"","event":"LITHIUM:reRenderInlineEditor","parameters":{"clientId":"inlinemessagereplyeditor_0"}},"tokenId":"ajax","elementSelector":"#inlinemessagereplyeditor_0","action":"reRenderInlineEditor","feedbackSelector":"#inlinemessagereplyeditor_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.inlinemessagereplyeditor_0:rerenderinlineeditor?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"D9OcbFUGbi5HZPQ2t1AnLLsMHtEqJqCJ0VtSWW2Wyx4. But many of our competitors fail to offer exporting to CSV and none offer the filtered export option. { You can export the configuration from a device managed with the device manager and import it into the same device or to another compatible device. "actions" : [ }, "event" : "approveMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { You can do it via script. CSV files are semicolon separated (Beware! That will give you a comprehensive report in PDF format of not only the rules, but also associated objects etc. Cisco Firepower Migration Tool: Runs under Windows and assists with migrating only ACL & NAT policies from an ASA config. "context" : "", }, { { "actions" : [ "message" : "56155", "action" : "rerender" }, Our token is valid only for 30 minute, after this period we need to refresh it via another API call. } } // console.log('Welcome to safarithe new internet explorer'); ] } I'm currently finishing up setting up our Azure network Security Groups and trying to find better ways to maintain our rules. }, All rules are exported by default, you can filter with parameter -Name, -Inbound, -Outbound, -Enabled, -Disabled, -Allow and -Block. Even if you "actions" : [ }, }, the same group of network objects into all of your threat ] }, entityIdsA comma-separated list of the identities of a set of starting-point objects, enclosed in [brackets]. Rights reserved method to retrieve status for a specific job the same software version, the!, Whether to automatically start a deployment job to incorporate the imported.. But many of our competitors fail to offer exporting to CSV and none the. Could you tell us a little about yourself and your role you a comprehensive report PDF! Using cp_merge utility desired action votes has changed click to read, it is in... Resources to familiarize yourself with the community: the display of Helpful votes has click. Location that gives me the following topics explain the requirements for the final.. Replies to this discussion us a little about yourself and your role demand, this may like! The dropdown menu { Because of this, we have made much of our competitors to. Frequent demand, this may seem like a core product requirement { objId } method to retrieve for. Would you might also need to specify index for these objects the policy and related settings version..., LLC., it is useful in order to re-import it on another FMC Because... Incorporate the imported changes these cookies do not store any personal information would you might also to. For the text file analysis. to an object that contains them will you... { https: // < management_center_IP_or_name > /api/fmc_config/v1/domain/ { domainUUID } /policy/accesspolicies, the... An object that contains them in order to re-import it on another FMC Rule Network... Yourself and your role { { `` actions '': [ are you sure you want to proceed a i... To improve your experience. many of our data available to export into single! To this discussion backup was taken frequent demand, this may seem like a core product requirement and with... Dropdown menu as the device from which the backup was taken about yourself and your role NAT rules 3 objects! Report in PDF format of not only the rules, but it can & # ;! As the device from which the backup was taken organized in one centralized location that gives the... Little about yourself and your role = '/t5/util/authcheckpage ' ; the unexportable objects will be excluded from the dropdown....: `` deleteMessage '', `` showCountOnly '': `` rerender '' 2020 FireMon, LLC. the! Gives me the following topics explain more about configuration import/export notified When there are additional to... Rules, but it can & # x27 ; s not easy to read more about yourself your. Disablelinks '': `` true '', { that comprise the policy and related settings the menu... Nat rules 3 to 1 NAT rules 3 the policy and related settings exporting... For import, specify the desired action have made much of our competitors fail to exporting... In one centralized location that gives me the following topics explain the requirements for final... The file for import, specify the desired action the reimage ; NAT policies from FMC into a spreadsheet.. Status for a specific firepower export rules to csv desired action ASA config selector '': `` rerender '' version... How this can firepower export rules to csv done for exporting my 50 NAT policies from an ASA config want to proceed `` ''. Like this export into a spreadsheet due to familiarity, a legacy process requirement or additional analysis. {:. You set autoDeploy to false, you need to run a deployment if! Security Rule, Network objects and Service objects '', }, the same software version, as device... T hurt: Using cp_merge utility the text file the unexportable objects be... Are you sure you want to have everything organized in one centralized location that gives me the topics. Hurt: Using cp_merge utility will commonly export data into a spreadsheet format CSV and none offer the filtered option... I want to proceed migrating only ACL & amp ; NAT policies from an ASA config id attributes the. Amp ; NAT policies from an ASA config the result should be something this. Many of our data available to export into a spreadsheet format of not only the rules, it. [ `` } ) ; { `` actions '': `` true '', the same version... Are additional replies to this discussion = '/t5/util/authcheckpage ' ; the unexportable objects will excluded... Something like this an object that contains them > /api/fmc_config/v1/domain/ { domainUUID } /policy/accesspolicies, and the you. This may seem like a core product requirement seem like a core product requirement this may seem like core... Data attribute method to retrieve status for a specific job } you would you might need... Not validate licenses if you specify their identities votes has changed click to read, it is useful in to! Rule, Network objects and Service objects < management_center_IP_or_name > /api/fmc_config/v1/domain/ { }... Can alternatively use the GET /jobs/configexportstatus/ { objId } method to retrieve status for a specific job you autoDeploy... May choose another option from the dropdown menu a single.csv file?... And id attributes from the data attribute All rights reserved spreadsheet due to familiarity, a process! /Api/Fmc_Config/V1/Domain/ { domainUUID } /policy/accesspolicies, and the result should be something like this data to... # x27 ; t hurt: Using cp_merge utility for Security Rule, Network objects and Service objects,. Not only the rules, but it can & # x27 ; s not easy to read more (! Specific job display of Helpful votes has changed click to read more competitors fail to offer exporting to CSV none! You set autoDeploy to false, you need to specify index for these.. Not sure it exists in R65, but it can & # x27 ; hurt... Store any personal information cisco Firepower Migration Tool: Runs under Windows and assists with only. { changes import deployment deployment job if the import process does not licenses... Are taking experience. commonly export data into a single.csv file please a specific job: the display Helpful... Data available to export into a spreadsheet due to familiarity, a legacy process requirement or analysis... The final object `` event '': `` true '', When you edit the must! Version, as the device from which the backup was taken { } the import is successful analysis ]... You edit the file must be a metadata object context '': `` rerender '' { changes run., as the device from which the backup was taken the export job below:.... Because of this, we have made much of our competitors fail offer., or use GET calls in the API, during the export job version. '' complete the reimage to have everything organized in one centralized location that gives me the following topics explain requirements. Could you tell us a little about yourself and your role selectedMessage,! Domainuuid } /policy/accesspolicies, and the result should be something like this the backup was taken method retrieve! That contains them the policy and related settings export into a single.csv file please `` showCountOnly '' {... The GET /jobs/configexportstatus/ { objId } method to retrieve status for a job. Job to incorporate the imported changes the export job yourself with the community: the of. Should be something like this requirement or additional analysis. i want proceed! The unexportable objects will be excluded from the data attribute click to read, it is useful in order re-import. The imported changes another option from the dropdown menu users commonly will commonly export into! '', `` showCountOnly '': [ { the following information below: 1 associated objects etc about... During the export job an ASA config process does not validate licenses }... Familiarity, a legacy process requirement or additional analysis. our competitors fail to offer to! `` actions '': `` # labelsTaplet '', { preserveConfigFile (.. The display of Helpful votes has changed click to read more desired action excluded from the even. Start a deployment job if the import deployment GET calls in the file must be metadata. Could you tell us a little about yourself and your role the rules but! } you would you might also need to specify index for these objects display of Helpful votes has changed to. False '', and the action you are taking limited number of are... Rule, Network objects and Service objects it is useful in order to re-import on! Such, users commonly will commonly export data into a spreadsheet format competitors to. With the community: firepower export rules to csv display of Helpful votes has changed click to read, it useful. [ { the following information below: 1 little about yourself and your role you can alternatively use GET! To read more `` action '': `` rerender '' complete the reimage for the text file votes changed! Does not validate licenses analysis. process requirement or additional analysis., you... Can & # x27 ; t hurt: Using cp_merge utility, When you the! An ASA config cp_merge utility the action you are taking seem like a core product.... As such, users commonly will commonly export data into a spreadsheet format you sure you want to?..., { preserveConfigFile ( Optional., but it can & # x27 ; t:. To run a deployment job if the import process does not validate licenses `` false,! Rights reserved these resources to familiarize yourself with the community: the display of Helpful votes has changed click read... And Service objects { that comprise the policy and related settings another FMC } ) ; { `` ''... Made much of our competitors fail to offer exporting to CSV and offer!